Is triskfreeappinstalldeviceinstall.cyou Legit?
-
Website
triskfreeappinstalldeviceinstall.cyou
-
Industry/Niche
Jewelry
*Suggest a new industry?
Is triskfreeappinstalldeviceinstall.cyou legit? Its medium-low trust score caused us to flag this site as questionable. We utilized 53 powerful factors to expose high-risk activity and see if triskfreeappinstalldeviceinstall.cyou is a scam. Let's look at it and its Jewelry industry through an in-depth review. You'll also learn how to detect and block scam websites and what you can do if you already lost your money.
The Scam Detector’s algorithm gives this business the following rank:
38.5/100
After you read why triskfreeappinstalldeviceinstall.cyou received this less-than-stellar score, please share how you came across this platform in the comments.
Scam Detectors Most Trusted Websites in Online Security
Guard.io (100): Protect your digital world on any device – Guardio stops scams and phishing in their tracks.
ExpressVPN (100) Stay secure and anonymous online - Best VPN Out There!
Incogni.com (100): Delete your personal data from the internet and protect against scams and identity theft.
What Is triskfreeappinstalldeviceinstall.cyou? Company Overview
-
Domain Creation Date
Thursday 3rd, June 2021 12:00 am
-
Domain Blacklist Status
Not detected by any blacklist engine
-
HTTPS Connection
Valid HTTPS Found
-
Proximity to Suspicious Websites
31/100
-
Phishing Score
57/100
-
Malware Score
34/100
-
Spam Score
1/100
triskfreeappinstalldeviceinstall.cyou
triskfreeappinstalldeviceinstall.cyou claims an association with the bustling Jewelry industry. We tried to extract some content from the website to see what they say about themselves. Here's the conclusion:
This website is for sale! triskfreeappinstalldeviceinstall.cyou is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, triskfreeappinstalldeviceinstall.cyou has it all. We hope you find what you are searching for!
Read more about what we found out about triskfreeappinstalldeviceinstall.cyou below.
triskfreeappinstalldeviceinstall.cyou Technical Analysis
Key Facts
Domain age
2 years, 11 months
triskfreeappinstalldeviceinstall.cyou Review
The Scam Detector website Validator gives triskfreeappinstalldeviceinstall.cyou a low trust score on the platform: 38.5. It signals that the business could be defined by the following tags: Questionable. Controversial. Flagged.. We are confident about our score as we also partner with other high-tech, fraud-prevention companies that found the same issues. So, why this low score? We came up with the 38.5 score based on 53 aggregated factors relevant to triskfreeappinstalldeviceinstall.cyou's industry. The algorithm detected possible high-risk activity related to phishing, spamming, and other factors noted in the Questionable. Controversial. Flagged. tags above. Long story short, we caution you about using this website. But let's explain in more detail.
Explaining Our Analytical Approach
We've displayed some important information within the Company Details section above, each deserving more explanation:
- Proximity to Suspicious Websites
- Threat Profile
- Phishing Profile
- Malware Score
- Spam Score
- Domain Blacklist Status
- HTTPS connection
- Domain Creation Date
While some are self-explanatory concerning triskfreeappinstalldeviceinstall.cyou, let's dive deeper into the remaining ones.
Proximity to Potentially Harmful Websites
This metric gauges the connection, scored on a scale of 1 to 100, between triskfreeappinstalldeviceinstall.cyou and websites marked as suspicious. Elevated scores point to a stronger link with these questionable online destinations. It's worth noting that website owners might not always be aware of their site's proximity to these dubious platforms or servers. However, a "Proximity to Suspicious Websites" score surpassing 80 strongly indicates a high-risk website, while a score below 30 signifies a less-threatening site.
Risk Factors: Threat, Phishing, Malware, and Spam
These indicators reveal the vulnerabilities and elements embedded within the HTML code of triskfreeappinstalldeviceinstall.cyou. They become especially pertinent if the website has received reports from internet users who've encountered unsolicited emails, ads, or messages related to the site. In the context of triskfreeappinstalldeviceinstall.cyou, our investigation continues working to pinpoint the specific category, but we welcome your insights in the comments below. A high Malware score generally implies the presence of suspicious code that might be unknowingly disseminated. Conversely, a high Spam score hints at a possibly spam-ridden email address associated with the business. Scores under 30 in both categories are reassuring, but any score surpassing this threshold should raise concerns. triskfreeappinstalldeviceinstall.cyou is a questionable website, given all the risk factors and data numbers analyzed in this in-depth review. Share your experience in the comments.
Domain Blacklisting Status
This term indicates whether triskfreeappinstalldeviceinstall.cyou has landed on any online directories' blacklists and earned a suspicious tag.
Assessing HTTPS Connectivity
This section provides insight into whether triskfreeappinstalldeviceinstall.cyou boasts an 's' at the end of the 'HTTP' protocol listed in your browser's address bar. If the tab displays in green, consider it a positive sign.
Safe Check
We want our trust scores and reviews to be as accurate as possible so that you can protect yourself from online fraud. Our algorithm aggregates factors that efficiently analyze a company's website, in this case, triskfreeappinstalldeviceinstall.cyou.
Is triskfreeappinstalldeviceinstall.cyou a Scam? Share Your Experience
How did you find this company/page? Online ads, suspicious Facebook advertisements, Instagram, email? You can help out many people today by commenting below.. Is triskfreeappinstalldeviceinstall.cyou a scam? If you interacted with this website, what score would you give it? Please share your experience below by leaving a review. Now, let's look at some powerful fraud prevention tips.
Top 5 Effective Ways To Spot a Scam Website [VIDEO]
There are many types of fake sites in the online world. We have some good news. Watch the video below to see the 5 effective ways you can spot a fraudulent website in 2024:
How To Remove Your Information From the Internet
Whether you like it or not, unfortunately, the Internet has all your personal information stored. How did that happen? Every time you visit a simple site and accept cookies, consent to their forms, or download an app, unscrupulous data brokers collect not just your phone number, name, AND address. They also sell this to third parties, which creates a $1 billion industry a year. Your collected personal data is used by buyers to send you never-ending spam emails, targeted ads, and, of course, telemarketing calls. Crooks use all your data without remorse.
We can help. Many people have asked us about how to remove your personal information from the Internet. If you want your data deleted entirely from the online world, contact our official partners at Incogni immediately. This legitimate data privacy tool works on your behalf to officially require a ton of online brokers to remove your data.
Our staff verifies that this service works and is trustworthy. For robust, essential protection, their Standard plan is a steal at just $8.29 for individuals, and you can extend that crucial peace of mind to your entire household with the Family plan (up to 5 users) for only $16.49. They also introduced the Unlimited plan starting from $14.99 that covers not only automatic data removals, but also unlimited custom removals available right away upon purchasing the Unlimited plan. It allows users to submit websites not yet covered by Incogni and get their data removed from there, too. They also offer a free exposure scanner that will give you an insight into what data of yours is exposed and where.
U.S., UK, EU, Swiss, and Canadian residents only. Click below. 
How To Report Scams: FTC
Do you want to know how to report triskfreeappinstalldeviceinstall.cyou or other online scammers?Contact the Federal Trade Commission and fill out the form. You can also write down the names of suspicious sites or individuals in the comments section below. You will help thousands of potential victims.
How To Recognize Red Flags Online
Last but not least, here is another must-watch video you don't want to miss:
How To Protect Your Online Browsing From Installing Malware
We have two more powerful fraud prevention tools that you should know about. We've been asked over and over again about the most effective ways to stay safe online. After testing several fraud prevention products online, we could certainly say the winner is a browser extension called Guardio. It automatically blocks 100x more harmful websites than competitors and 10x more malicious downloads than any other security tool. It was tested and vetted by our Scam Detector team.
Guardio has over a million users, and while it is already affordable for the benefits it provides (just a few dollars a month), it covers up to 5 family members. For Scam Detector readers exclusively, Guardio offers a 20% discount this week. You can protect your online browsing from installing malware forever by clicking the button below: 
How To Stop Third Parties From Tracking Your Devices
The second most powerful fraud prevention tool you should consider is Surfshark. Here is why you should get it now, as the first 5 months are free:
- They have an award-winning VPN service, protecting your privacy and preventing third parties from tracking your device.
- They will notify you when your personal info is leaked online so you can delete your private data from the Internet immediately.
- Surfshark has a super powerful antivirus program. It offers you effective protection from viruses and zero-day threats, a lightweight, clean, and easy-to-use app, and a 30-day money-back guarantee.
- Check this: They hide your online searches, which means you will get only organic search results without tracking and follow-up ads. For example, when you search for a flight, and the next time you look at the same search, the prices are higher. With Surfshark, this doesn't happen.
For the Black Friday promotion, Surfshark offers 86% off + up to 5 months free to Scam Detector readers. You can get the deal only this week HERE or by clicking the button below. 
Did You Lose Money to Any Scams?
Whether you have already lost money or not, when it comes to ANY type of fraud (other credit card scams, eBay, PayPal, financial, even romance scams, etc.), we are here to help. We have partnered with several powerful asset recovery companies. In an effort to help scam victims, we can take a look at your case. If you lost more than $1,000US to any type of fraud, please tell us your story and fill outTHIS FORM. The process of recovering the money is extensive and requires a lot of work. However, we're happy to take a look, so hopefully, you'll get your money back.
Fraud Related Articles
Here are more resources for you. Feel free to check out the educational articles below: Amazon Pallets For Sale: The Biggest Scam of the Year Cryptocurrency Scams: Complete List Crypto Scammed? We May Be Able To Help Recover Your Money Text Message Scams: Complete List Coinbase Text Scam How To Stop Robocalls Discord Scams: FULL LIST Telegram Scams: FULL LIST
Share This Page About triskfreeappinstalldeviceinstall.cyou and Help Others
If you found this page helpful, please share it with your online friends. The social media buttons are at the top of this page.
Are You the Owner of triskfreeappinstalldeviceinstall.cyou?
If you own triskfreeappinstalldeviceinstall.cyou, we’d love to hear from you. If you'd like to challenge the trust score we’ve assigned, we’re happy to take a closer look. However, please be prepared to provide solid proof of your business's legitimacy. Introduce yourself with your name (not just "Admin").
When domain owners contact us to dispute their trust score, we kindly ask for the following:
* Business documentation that verifies your legitimacy (e.g., certificate of incorporation, business registration, or official records with the site or business name).
* Your personal LinkedIn profile and the business's social media accounts (e.g., Facebook).
* If available, proof of satisfied customers (e.g., screenshots, not just testimonials on your website), evidence of inventory, or records of handling order cancellations properly.
We’re more than willing to update your review based on the evidence you provide—the more proof, the higher your trust score. Please note, however, that we cannot verify non-operational websites or those redirected to other URLs. Additionally, we do not verify websites involved in high-risk financial services, gambling, adult content, or illegal activities.
Please send the following via email to [email protected].



Leave a Comment
Your email address will not be published. Required fields are marked *